Lineage for d1r1ub_ (1r1u B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. Protein Metal-sensing transcriptional repressor CzrA [109664] (1 species)
  7. Species Staphylococcus aureus [TaxId:1280] [109665] (3 PDB entries)
    Uniprot O85142
  8. Domain d1r1ub_: 1r1u B: [104772]

Details for d1r1ub_

PDB Entry: 1r1u (more details), 2 Å

PDB Description: Crystal structure of the metal-sensing transcriptional repressor CzrA from Staphylococcus aureus in the apo-form
PDB Compounds: (B:) repressor protein

SCOPe Domain Sequences for d1r1ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1ub_ a.4.5.5 (B:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]}
ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
vkakrqgqsmiyslddihvatmlkqaihhanhp

SCOPe Domain Coordinates for d1r1ub_ are not available.

Timeline for d1r1ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r1ua_, d1r1uc_, d1r1ud_