![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
![]() | Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) ![]() |
![]() | Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (6 proteins) Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains |
![]() | Protein Choline O-acetyltransferase, N-terminal domain [418984] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [419456] (2 PDB entries) Uniprot P32738 |
![]() | Domain d1q6xa1: 1q6x A:18-401 [104541] Other proteins in same PDB: d1q6xa2, d1q6xb2 complexed with na has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1q6x (more details), 2.5 Å
SCOPe Domain Sequences for d1q6xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q6xa1 c.43.1.3 (A:18-401) Choline O-acetyltransferase, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} weeldlpklpvpplqqtlatylqcmqhlvpeeqfrksqaivkrfgapgglgetlqeklle rqektanwvseywlndmylnnrlalpvnsspavifarqhfqdtndqlrfaaclisgvlsy ktlldshslptdwakgqlsgqplcmkqyyrlfssyrlpghtqdtlvaqkssimpepehvi vaccnqffvldvvinfrrlsegdlftqlrkivkmasnederlppiglltsdgrsewakar tvllkdstnrdsldmierciclvcldgpgtgelsdthralqllhgggcslnganrwydks lqfvvgrdgtcgvvcehspfdgivlvqctehllkhmmtsnkklvradsvselpaprrlrw kcspetqghlassaeklqrivknl
Timeline for d1q6xa1: