SCOPe 2.08: Domain d1q6xb1: 1q6x B:18-401

Lineage for d1q6xb1 (1q6x B:18-401)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (6 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Choline O-acetyltransferase, N-terminal domain [418984] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [419456] (2 PDB entries)
   Uniprot P32738

8. Domain d1q6xb1: 1q6x B:18-401 [104543]
   Other proteins in same PDB: d1q6xa2, d1q6xb2
   complexed with na
   has additional insertions and/or extensions that are not grouped together

Details for d1q6xb1

PDB Entry: 1q6x, 2.5 Å

PDB Description: Crystal structure of rat choline acetyltransferase

PDB Compounds: (B:) choline O-acetyltransferase

SCOPe Domain Sequences for d1q6xb1:

Sequence; same for both SEQRES and ATOM records:

>d1q6xb1 c.43.1.3 (B:18-401) Choline O-acetyltransferase, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
weeldlpklpvpplqqtlatylqcmqhlvpeeqfrksqaivkrfgapgglgetlqeklle
rqektanwvseywlndmylnnrlalpvnsspavifarqhfqdtndqlrfaaclisgvlsy
ktlldshslptdwakgqlsgqplcmkqyyrlfssyrlpghtqdtlvaqkssimpepehvi
vaccnqffvldvvinfrrlsegdlftqlrkivkmasnederlppiglltsdgrsewakar
tvllkdstnrdsldmierciclvcldgpgtgelsdthralqllhgggcslnganrwydks
lqfvvgrdgtcgvvcehspfdgivlvqctehllkhmmtsnkklvradsvselpaprrlrw
kcspetqghlassaeklqrivknl

Timeline for d1q6xb1:

• d1q6xb1 first appeared in SCOP 1.69
  
• d1q6xb1 appears in SCOPe 2.07