PDB entry 1q6x

View 1q6x on RCSB PDB site
Description: Crystal structure of rat choline acetyltransferase
Class: transferase
Keywords: alpha beta sandwich, extended loop, two domains, transferase
Deposited on 2003-08-14, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choline O-acetyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: cholinergic gene locus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32738
      • see remark 999 (233)
    Domains in SCOPe 2.07: d1q6xa1, d1q6xa2
  • Chain 'B':
    Compound: choline O-acetyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: cholinergic gene locus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32738
      • see remark 999 (233)
    Domains in SCOPe 2.07: d1q6xb1, d1q6xb2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q6xA (A:)
    mpilekapqkmpvkassweeldlpklpvpplqqtlatylqcmqhlvpeeqfrksqaivkr
    fgapgglgetlqekllerqektanwvseywlndmylnnrlalpvnsspavifarqhfqdt
    ndqlrfaaclisgvlsyktlldshslptdwakgqlsgqplcmkqyyrlfssyrlpghtqd
    tlvaqkssimpepehvivaccnqffvldvvinfrrlsegdlftqlrkivkmasnederlp
    piglltsdgrsewakartvllkdstnrdsldmierciclvcldgpgtgelsdthralqll
    hgggcslnganrwydkslqfvvgrdgtcgvvcehspfdgivlvqctehllkhmmtsnkkl
    vradsvselpaprrlrwkcspetqghlassaeklqrivknldfivykfdnygktfikkqk
    yspdgfiqvalqlayyrlyqrlvptyesasirrfqegrvdnirsatpealafvqamtdhk
    aampaseklqllqtamqaqteytvmaitgmaidnhllalrelardlckeppemfmdetyl
    msnrfvlstsqvpttmemfccygpvvpngygacynpqpeaitfcissfhscketssvefa
    eavgaslvdmrdlcssrqpadskppapkekargptkpsnldssh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6xA (A:)
    weeldlpklpvpplqqtlatylqcmqhlvpeeqfrksqaivkrfgapgglgetlqeklle
    rqektanwvseywlndmylnnrlalpvnsspavifarqhfqdtndqlrfaaclisgvlsy
    ktlldshslptdwakgqlsgqplcmkqyyrlfssyrlpghtqdtlvaqkssimpepehvi
    vaccnqffvldvvinfrrlsegdlftqlrkivkmasnederlppiglltsdgrsewakar
    tvllkdstnrdsldmierciclvcldgpgtgelsdthralqllhgggcslnganrwydks
    lqfvvgrdgtcgvvcehspfdgivlvqctehllkhmmtsnkklvradsvselpaprrlrw
    kcspetqghlassaeklqrivknldfivykfdnygktfikkqkyspdgfiqvalqlayyr
    lyqrlvptyesasirrfqegrvdnirsatpealafvqamtdhkaampaseklqllqtamq
    aqteytvmaitgmaidnhllalrelardlckeppemfmdetylmsnrfvlstsqvpttme
    mfccygpvvpngygacynpqpeaitfcissfhscketssvefaeavgaslvdmrdlcssr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q6xB (B:)
    mpilekapqkmpvkassweeldlpklpvpplqqtlatylqcmqhlvpeeqfrksqaivkr
    fgapgglgetlqekllerqektanwvseywlndmylnnrlalpvnsspavifarqhfqdt
    ndqlrfaaclisgvlsyktlldshslptdwakgqlsgqplcmkqyyrlfssyrlpghtqd
    tlvaqkssimpepehvivaccnqffvldvvinfrrlsegdlftqlrkivkmasnederlp
    piglltsdgrsewakartvllkdstnrdsldmierciclvcldgpgtgelsdthralqll
    hgggcslnganrwydkslqfvvgrdgtcgvvcehspfdgivlvqctehllkhmmtsnkkl
    vradsvselpaprrlrwkcspetqghlassaeklqrivknldfivykfdnygktfikkqk
    yspdgfiqvalqlayyrlyqrlvptyesasirrfqegrvdnirsatpealafvqamtdhk
    aampaseklqllqtamqaqteytvmaitgmaidnhllalrelardlckeppemfmdetyl
    msnrfvlstsqvpttmemfccygpvvpngygacynpqpeaitfcissfhscketssvefa
    eavgaslvdmrdlcssrqpadskppapkekargptkpsnldssh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6xB (B:)
    weeldlpklpvpplqqtlatylqcmqhlvpeeqfrksqaivkrfgapgglgetlqeklle
    rqektanwvseywlndmylnnrlalpvnsspavifarqhfqdtndqlrfaaclisgvlsy
    ktlldshslptdwakgqlsgqplcmkqyyrlfssyrlpghtqdtlvaqkssimpepehvi
    vaccnqffvldvvinfrrlsegdlftqlrkivkmasnederlppiglltsdgrsewakar
    tvllkdstnrdsldmierciclvcldgpgtgelsdthralqllhgggcslnganrwydks
    lqfvvgrdgtcgvvcehspfdgivlvqctehllkhmmtsnkklvradsvselpaprrlrw
    kcspetqghlassaeklqrivknldfivykfdnygktfikkqkyspdgfiqvalqlayyr
    lyqrlvptyesasirrfqegrvdnirsatpealafvqamtdhkaampaseklqllqtamq
    aqteytvmaitgmaidnhllalrelardlckeppemfmdetylmsnrfvlstsqvpttme
    mfccygpvvpngygacynpqpeaitfcissfhscketssvefaeavgaslvdmrdlcssr