SCOP 1.69: Domain d1q6xa1: 1q6x A:18-401

Lineage for d1q6xa1 (1q6x A:18-401)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase (Pfam 00755) [82424] (2 proteins)
   monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Choline O-acetyltransferase [110591] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110592] (1 PDB entry)

8. Domain d1q6xa1: 1q6x A:18-401 [104541]

Details for d1q6xa1

PDB Entry: 1q6x, 2.5 Å

PDB Description: Crystal structure of rat choline acetyltransferase

SCOP Domain Sequences for d1q6xa1:

Sequence; same for both SEQRES and ATOM records:

>d1q6xa1 c.43.1.3 (A:18-401) Choline O-acetyltransferase {Rat (Rattus norvegicus)}
weeldlpklpvpplqqtlatylqcmqhlvpeeqfrksqaivkrfgapgglgetlqeklle
rqektanwvseywlndmylnnrlalpvnsspavifarqhfqdtndqlrfaaclisgvlsy
ktlldshslptdwakgqlsgqplcmkqyyrlfssyrlpghtqdtlvaqkssimpepehvi
vaccnqffvldvvinfrrlsegdlftqlrkivkmasnederlppiglltsdgrsewakar
tvllkdstnrdsldmierciclvcldgpgtgelsdthralqllhgggcslnganrwydks
lqfvvgrdgtcgvvcehspfdgivlvqctehllkhmmtsnkklvradsvselpaprrlrw
kcspetqghlassaeklqrivknl

Timeline for d1q6xa1:

• d1q6xa1 is new in SCOP 1.69
  
• d1q6xa1 appears in SCOP 1.71
  
• d1q6xa1 appears in the current release, SCOPe 2.08