![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [102159] (12 PDB entries) Uniprot P44801 |
![]() | Domain d1pqub1: 1pqu B:1-133,B:358-371 [104290] Other proteins in same PDB: d1pqua2, d1pqub2, d1pquc2, d1pqud2 complexed with cac, cys, nap; mutant |
PDB Entry: 1pqu (more details), 1.92 Å
SCOPe Domain Sequences for d1pqub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pqub1 c.2.1.3 (B:1-133,B:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]} mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi seglkkgiktfvgXaaepvrrilkqlva
Timeline for d1pqub1: