Lineage for d1pqub2 (1pqu B:134-357)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. Species Haemophilus influenzae [TaxId:727] [103103] (12 PDB entries)
    Uniprot P44801
  8. Domain d1pqub2: 1pqu B:134-357 [104291]
    Other proteins in same PDB: d1pqua1, d1pqub1, d1pquc1, d1pqud1
    complexed with cac, cys, nap; mutant

Details for d1pqub2

PDB Entry: 1pqu (more details), 1.92 Å

PDB Description: Crystal Structure of the H277N Mutant of Aspartate Semialdehyde Dehydrogenase from Haemophilus influenzae Bound with NADP, S-methyl cysteine sulfoxide and cacodylate
PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1pqub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqub2 d.81.1.1 (B:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
gnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd
passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnk
ilglsdnpipvdglcvrigalrcnsqaftiklkkdlpleeieqiiashnewvkvipndke
itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg

SCOPe Domain Coordinates for d1pqub2 are not available.

Timeline for d1pqub2:

Domains from same chain:
(mouse over for more information)
d1pqub1
Domains from other chains:
(mouse over for more information)
d1pqua1, d1pqua2, d1pquc1, d1pquc2, d1pqud1, d1pqud2