Lineage for d1p5qb1 (1p5q B:258-427)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. Protein FKBP52 (FKBP4), C-terminal domain [109971] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [109972] (2 PDB entries)
    Uniprot Q02790 145-427
  8. Domain d1p5qb1: 1p5q B:258-427 [104070]
    Other proteins in same PDB: d1p5qa2, d1p5qa3, d1p5qb2, d1p5qb3, d1p5qc2, d1p5qc3
    second FKPB domain
    complexed with so4

Details for d1p5qb1

PDB Entry: 1p5q (more details), 2.8 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain
PDB Compounds: (B:) FK506-binding protein 4

SCOPe Domain Sequences for d1p5qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5qb1 a.118.8.1 (B:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
swemnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqal
rlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfq
kvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka

SCOPe Domain Coordinates for d1p5qb1 are not available.

Timeline for d1p5qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p5qb2, d1p5qb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1p5qa1, d1p5qa2, d1p5qa3, d1p5qc1, d1p5qc2, d1p5qc3