![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein FKBP52 (FKBP4), C-terminal domain [109971] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109972] (2 PDB entries) Uniprot Q02790 145-427 |
![]() | Domain d1p5qa1: 1p5q A:258-427 [104068] Other proteins in same PDB: d1p5qa2, d1p5qa3, d1p5qb2, d1p5qb3, d1p5qc2, d1p5qc3 second FKPB domain complexed with so4 |
PDB Entry: 1p5q (more details), 2.8 Å
SCOPe Domain Sequences for d1p5qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} swemnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqal rlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfq kvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka
Timeline for d1p5qa1: