Lineage for d1p5qa2 (1p5q A:146-257)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941444Protein FKBP52, N-terminal domains [82619] (1 species)
  7. 2941445Species Human (Homo sapiens) [TaxId:9606] [82620] (11 PDB entries)
    Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains
  8. 2941460Domain d1p5qa2: 1p5q A:146-257 [104069]
    Other proteins in same PDB: d1p5qa1, d1p5qa3, d1p5qb1, d1p5qb3, d1p5qc1, d1p5qc3
    second FKPB domain
    complexed with so4

Details for d1p5qa2

PDB Entry: 1p5q (more details), 2.8 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain
PDB Compounds: (A:) FK506-binding protein 4

SCOPe Domain Sequences for d1p5qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5qa2 d.26.1.1 (A:146-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
edggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygle
raiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake

SCOPe Domain Coordinates for d1p5qa2:

Click to download the PDB-style file with coordinates for d1p5qa2.
(The format of our PDB-style files is described here.)

Timeline for d1p5qa2: