Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Hepsin, catalytic domain [101813] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101814] (4 PDB entries) Uniprot P05981 163-417 |
Domain d1o5fh_: 1o5f H: [103887] Other proteins in same PDB: d1o5fl_ complexed with cr9 |
PDB Entry: 1o5f (more details), 1.78 Å
SCOPe Domain Sequences for d1o5fh_:
Sequence, based on SEQRES records: (download)
>d1o5fh_ b.47.1.2 (H:) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq aikthseasgmvtql
>d1o5fh_ b.47.1.2 (H:) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav aqasphglqlgvqavvyhggylpfnsndialvhlssplplteyiqpvclpaagqalvdgk ictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagypeggidac qgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifqaikthse asgmvtql
Timeline for d1o5fh_: