SCOPe 2.08: Domain d1o5fl_: 1o5f L:

Lineage for d1o5fl_ (1o5f L:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.170: SRCR-like [56486] (2 superfamilies)
   unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta

4. Superfamily d.170.1: SRCR-like [56487] (3 families)

5. Family d.170.1.2: Hepsin, N-terminal domain [103355] (1 protein)
   automatically mapped to Pfam PF09272

6. Protein Hepsin, N-terminal domain [103356] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103357] (4 PDB entries)
   Uniprot P05981 50-159

8. Domain d1o5fl_: 1o5f L: [103888]
   Other proteins in same PDB: d1o5fh_
   complexed with cr9

Details for d1o5fl_

PDB Entry: 1o5f, 1.78 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

PDB Compounds: (L:) Serine protease hepsin

SCOPe Domain Sequences for d1o5fl_:

Sequence; same for both SEQRES and ATOM records:

>d1o5fl_ d.170.1.2 (L:) Hepsin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp

Timeline for d1o5fl_:

• d1o5fl_ first appeared in SCOP 1.69
  
• d1o5fl_ appears in SCOPe 2.07