Lineage for d1o5fl_ (1o5f L:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560043Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 2560044Superfamily d.170.1: SRCR-like [56487] (3 families) (S)
  5. 2560049Family d.170.1.2: Hepsin, N-terminal domain [103355] (1 protein)
    automatically mapped to Pfam PF09272
  6. 2560050Protein Hepsin, N-terminal domain [103356] (1 species)
  7. 2560051Species Human (Homo sapiens) [TaxId:9606] [103357] (4 PDB entries)
    Uniprot P05981 50-159
  8. 2560053Domain d1o5fl_: 1o5f L: [103888]
    Other proteins in same PDB: d1o5fh_
    complexed with cr9

Details for d1o5fl_

PDB Entry: 1o5f (more details), 1.78 Å

PDB Description: Dissecting and Designing Inhibitor Selectivity Determinants at the S1 site Using an Artificial Ala190 Protease (Ala190 uPA)
PDB Compounds: (L:) Serine protease hepsin

SCOPe Domain Sequences for d1o5fl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5fl_ d.170.1.2 (L:) Hepsin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp

SCOPe Domain Coordinates for d1o5fl_:

Click to download the PDB-style file with coordinates for d1o5fl_.
(The format of our PDB-style files is described here.)

Timeline for d1o5fl_: