Lineage for d1j3sa_ (1j3s A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980370Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 1980579Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 1980710Species Human (Homo sapiens) [TaxId:9606] [109644] (6 PDB entries)
    Uniprot P99999
  8. 1980723Domain d1j3sa_: 1j3s A: [103838]
    complexed with hec

Details for d1j3sa_

PDB Entry: 1j3s (more details)

PDB Description: Solution Structure of Reduced Recombinant Human Cytochrome c
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1j3sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3sa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d1j3sa_:

Click to download the PDB-style file with coordinates for d1j3sa_.
(The format of our PDB-style files is described here.)

Timeline for d1j3sa_: