![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Mitochondrial cytochrome c [46642] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109644] (13 PDB entries) Uniprot P99999 |
![]() | Domain d1j3sa_: 1j3s A: [103838] complexed with hec |
PDB Entry: 1j3s (more details)
SCOPe Domain Sequences for d1j3sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3sa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]} gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
Timeline for d1j3sa_: