Lineage for d1j3sa_ (1j3s A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437666Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 437667Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 437668Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 437826Protein Mitochondrial cytochrome c [46642] (6 species)
  7. 437886Species Human (Homo sapiens) [TaxId:9606] [109644] (1 PDB entry)
  8. 437887Domain d1j3sa_: 1j3s A: [103838]

Details for d1j3sa_

PDB Entry: 1j3s (more details)

PDB Description: Solution Structure of Reduced Recombinant Human Cytochrome c
PDB Compounds: (A:)

SCOP Domain Sequences for d1j3sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3sa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens)}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOP Domain Coordinates for d1j3sa_:

Click to download the PDB-style file with coordinates for d1j3sa_.
(The format of our PDB-style files is described here.)

Timeline for d1j3sa_: