Lineage for d1viqa1 (1viq A:1-207)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535541Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2535587Protein ADP-ribose pyrophosphatase [64365] (4 species)
  7. 2535588Species Escherichia coli [TaxId:562] [64366] (5 PDB entries)
  8. 2535597Domain d1viqa1: 1viq A:1-207 [100766]
    Other proteins in same PDB: d1viqa2, d1viqb2
    structural genomics

Details for d1viqa1

PDB Entry: 1viq (more details), 2.4 Å

PDB Description: crystal structure of putative adp ribose pyrophosphatase
PDB Compounds: (A:) ADP-ribose pyrophosphatase

SCOPe Domain Sequences for d1viqa1:

Sequence, based on SEQRES records: (download)

>d1viqa1 d.113.1.1 (A:1-207) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}
lkpdnlpvtfgkndveiiaretlyrgfssldlyrfrhrlfngqmshevrreiferghaav
llpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagliv
krtkpvlsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqwve
egkidnaasvialqwlqlhhqalknew

Sequence, based on observed residues (ATOM records): (download)

>d1viqa1 d.113.1.1 (A:1-207) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}
lkpdnlpvtfgkndveiiaretlyrgfssldlyrfrhrlfngqmshevrreiferghaav
llpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagliv
krtkpvlsflaspggtserssimvgevdattasgihgnedirvhvvsreqayqwveegki
dnaasvialqwlqlhhqalknew

SCOPe Domain Coordinates for d1viqa1:

Click to download the PDB-style file with coordinates for d1viqa1.
(The format of our PDB-style files is described here.)

Timeline for d1viqa1: