PDB entry 1viq

View 1viq on RCSB PDB site
Description: Crystal structure of putative ADP ribose pyrophosphatase
Class: hydrolase
Keywords: structural genomics, Hydrolase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribose pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: NUDF, B3034, C3780, Z4391, ECS3922, SF3074, S3279
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93K97 (2-End)
      • cloning artifact (1)
      • variant (29)
    Domains in SCOPe 2.07: d1viqa1, d1viqa2
  • Chain 'B':
    Compound: ADP-ribose pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: NUDF, B3034, C3780, Z4391, ECS3922, SF3074, S3279
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93K97 (2-End)
      • cloning artifact (1)
      • variant (29)
    Domains in SCOPe 2.07: d1viqb1, d1viqb2
  • Chain 'C':
    Compound: ADP-ribose pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: NUDF, B3034, C3780, Z4391, ECS3922, SF3074, S3279
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93K97 (Start-209)
      • variant (29)
    Domains in SCOPe 2.07: d1viqc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1viqA (A:)
    mslkpdnlpvtfgkndveiiaretlyrgfssldlyrfrhrlfngqmshevrreifergha
    avllpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagl
    ivkrtkpvlsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqw
    veegkidnaasvialqwlqlhhqalknewaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1viqA (A:)
    slkpdnlpvtfgkndveiiaretlyrgfssldlyrfrhrlfngqmshevrreiferghaa
    vllpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagli
    vkrtkpvlsflaspggtserssimvgevdattasgihgnedirvhvvsreqayqwveegk
    idnaasvialqwlqlhhqalknew
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1viqB (B:)
    mslkpdnlpvtfgkndveiiaretlyrgfssldlyrfrhrlfngqmshevrreifergha
    avllpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagl
    ivkrtkpvlsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqw
    veegkidnaasvialqwlqlhhqalknewaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1viqB (B:)
    slkpdnlpvtfgkndveiiaretlyrgfssldlyrfrhrlfngqmshevrreiferghaa
    vllpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagli
    vkrtkpvlsflaspggtserssimvgevdattasgihdirvhvvsreqayqwveegkidn
    aasvialqwlqlhhqalknew
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1viqC (C:)
    mslkpdnlpvtfgkndveiiaretlyrgfssldlyrfrhrlfngqmshevrreifergha
    avllpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagl
    ivkrtkpvlsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqw
    veegkidnaasvialqwlqlhhqalknewaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1viqC (C:)
    lpvtfgkndveiiaretlyrgfssldlyrfrhrlfngqmshevrreiferghaavllpfd
    pvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeaglivkrtkp
    vlsflaspggtserssimvgevdattanedirvhvvsreqayqwveegkidnaasvialq
    wlqlhhqalknewa