Lineage for d1viqc_ (1viq C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. Protein ADP-ribose pyrophosphatase [64365] (4 species)
  7. Species Escherichia coli [TaxId:562] [64366] (5 PDB entries)
  8. Domain d1viqc_: 1viq C: [100768]
    Other proteins in same PDB: d1viqa2, d1viqb2
    structural genomics
    has additional subdomain(s) that are not in the common domain

Details for d1viqc_

PDB Entry: 1viq (more details), 2.4 Å

PDB Description: crystal structure of putative adp ribose pyrophosphatase
PDB Compounds: (C:) ADP-ribose pyrophosphatase

SCOPe Domain Sequences for d1viqc_:

Sequence, based on SEQRES records: (download)

>d1viqc_ d.113.1.1 (C:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}
lpvtfgkndveiiaretlyrgfssldlyrfrhrlfngqmshevrreiferghaavllpfd
pvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeaglivkrtkp
vlsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqwveegkid
naasvialqwlqlhhqalknewa

Sequence, based on observed residues (ATOM records): (download)

>d1viqc_ d.113.1.1 (C:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]}
lpvtfgkndveiiaretlyrgfssldlyrfrhrlfngqmshevrreiferghaavllpfd
pvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeaglivkrtkp
vlsflaspggtserssimvgevdattanedirvhvvsreqayqwveegkidnaasvialq
wlqlhhqalknewa

SCOPe Domain Coordinates for d1viqc_ are not available.

Timeline for d1viqc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1viqa1, d1viqa2, d1viqb1, d1viqb2