Lineage for d1v2ad1 (1v2a D:84-208)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 356086Protein Class delta GST [81355] (5 species)
    formerly a part of class theta enzymes
  7. 356102Species Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId:123217] [101208] (1 PDB entry)
  8. 356106Domain d1v2ad1: 1v2a D:84-208 [100269]
    Other proteins in same PDB: d1v2aa2, d1v2ab2, d1v2ac2, d1v2ad2
    complexed with gts

Details for d1v2ad1

PDB Entry: 1v2a (more details), 2.15 Å

PDB Description: Glutathione S-transferase 1-6 from Anopheles dirus species B

SCOP Domain Sequences for d1v2ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2ad1 a.45.1.1 (D:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6}
kdpkvrsvvnqrlffdigtlykriidvihlvmkkeqpsdeqmeklkgaldlleqfvtera
yaaadhltvadicllgtvtalnwlkhdlepfphirawlervraempdyeefskqvaddtl
ayvas

SCOP Domain Coordinates for d1v2ad1:

Click to download the PDB-style file with coordinates for d1v2ad1.
(The format of our PDB-style files is described here.)

Timeline for d1v2ad1: