Lineage for d1v2ad1 (1v2a D:84-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713031Protein Class delta GST [81355] (6 species)
    formerly a part of class theta enzymes
  7. 2713052Species Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId:123217] [101208] (1 PDB entry)
  8. 2713056Domain d1v2ad1: 1v2a D:84-208 [100269]
    Other proteins in same PDB: d1v2aa2, d1v2ab2, d1v2ac2, d1v2ad2
    complexed with gts

Details for d1v2ad1

PDB Entry: 1v2a (more details), 2.15 Å

PDB Description: Glutathione S-transferase 1-6 from Anopheles dirus species B
PDB Compounds: (D:) glutathione transferase gst1-6

SCOPe Domain Sequences for d1v2ad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2ad1 a.45.1.1 (D:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]}
kdpkvrsvvnqrlffdigtlykriidvihlvmkkeqpsdeqmeklkgaldlleqfvtera
yaaadhltvadicllgtvtalnwlkhdlepfphirawlervraempdyeefskqvaddtl
ayvas

SCOPe Domain Coordinates for d1v2ad1:

Click to download the PDB-style file with coordinates for d1v2ad1.
(The format of our PDB-style files is described here.)

Timeline for d1v2ad1: