Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (14 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
Protein Class delta GST [81366] (5 species) formerly a part of class theta enzymes |
Species Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId:123217] [102440] (1 PDB entry) |
Domain d1v2ab2: 1v2a B:1-83 [100266] Other proteins in same PDB: d1v2aa1, d1v2ab1, d1v2ac1, d1v2ad1 |
PDB Entry: 1v2a (more details), 2.15 Å
SCOP Domain Sequences for d1v2ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v2ab2 c.47.1.5 (B:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6} mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv vwesyaivlylvetyakddtlyp
Timeline for d1v2ab2: