Lineage for d1v2ac2 (1v2a C:1-83)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396098Protein Class delta GST [81366] (5 species)
    formerly a part of class theta enzymes
  7. 396114Species Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId:123217] [102440] (1 PDB entry)
  8. 396117Domain d1v2ac2: 1v2a C:1-83 [100268]
    Other proteins in same PDB: d1v2aa1, d1v2ab1, d1v2ac1, d1v2ad1

Details for d1v2ac2

PDB Entry: 1v2a (more details), 2.15 Å

PDB Description: Glutathione S-transferase 1-6 from Anopheles dirus species B

SCOP Domain Sequences for d1v2ac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v2ac2 c.47.1.5 (C:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6}
mdyyyslisppcqsaillakklgitlnlkktnvhdpverdaltklnpqhtiptlvdnghv
vwesyaivlylvetyakddtlyp

SCOP Domain Coordinates for d1v2ac2:

Click to download the PDB-style file with coordinates for d1v2ac2.
(The format of our PDB-style files is described here.)

Timeline for d1v2ac2: