![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
![]() | Protein Protozoan/bacterial hemoglobin [46460] (6 species) |
![]() | Species Ciliate (Paramecium caudatum) [TaxId:5885] [46461] (2 PDB entries) |
![]() | Domain d1uvya_: 1uvy A: [100068] complexed with hem, xe |
PDB Entry: 1uvy (more details), 2.4 Å
SCOPe Domain Sequences for d1uvya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]} slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawt grnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv
Timeline for d1uvya_: