PDB entry 1uvy

View 1uvy on RCSB PDB site
Description: heme-ligand tunneling in group I truncated hemoglobins
Class: oxygen storage/transport
Keywords: oxygen storage/transport, ligand diffusion, heme
Deposited on 2004-01-27, released 2004-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Paramecium caudatum [TaxId:5885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uvya_
  • Heterogens: HEM, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvyA (A:)
    slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawt
    grnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv