Class a: All alpha proteins [46456] (202 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.1: Truncated hemoglobin [46459] (1 protein) lack the first helix (A) |
Protein Protozoan/bacterial hemoglobin [46460] (5 species) |
Species Ciliate (Paramecium caudatum) [TaxId:5885] [46461] (2 PDB entries) |
Domain d1uvya_: 1uvy A: [100068] complexed with hem, xe |
PDB Entry: 1uvy (more details), 2.4 Å
SCOP Domain Sequences for d1uvya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum)} slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawt grnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv
Timeline for d1uvya_: