Lineage for d1uvya_ (1uvy A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349262Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
    lack the first helix (A)
  6. 349263Protein Protozoan/bacterial hemoglobin [46460] (5 species)
  7. 349264Species Ciliate (Paramecium caudatum) [TaxId:5885] [46461] (2 PDB entries)
  8. 349266Domain d1uvya_: 1uvy A: [100068]
    complexed with hem, xe

Details for d1uvya_

PDB Entry: 1uvy (more details), 2.4 Å

PDB Description: heme-ligand tunneling in group i truncated hemoglobins

SCOP Domain Sequences for d1uvya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum)}
slfeqlggqaavqavtaqfyaniqadatvatffngidmpnqtnktaaflcaalggpnawt
grnlkevhanmgvsnaqfttvighlrsaltgagvaaalveqtvavaetvrgdvvtv

SCOP Domain Coordinates for d1uvya_:

Click to download the PDB-style file with coordinates for d1uvya_.
(The format of our PDB-style files is described here.)

Timeline for d1uvya_: