Lineage for d6y17a_ (6y17 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945445Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 2945446Species Human (Homo sapiens) [TaxId:9606] [102923] (37 PDB entries)
  8. 2945451Domain d6y17a_: 6y17 A: [396361]
    Other proteins in same PDB: d6y17b2
    automated match to d1r2ba_
    complexed with na
    has additional insertions and/or extensions that are not grouped together

Details for d6y17a_

PDB Entry: 6y17 (more details), 1.56 Å

PDB Description: crystal structure of an ncor1bbd2-bcl6btb chimera in complex with nebulinsh3-ncor1bbd1
PDB Compounds: (A:) Nuclear receptor corepressor 1,B-cell lymphoma 6 protein

SCOPe Domain Sequences for d6y17a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y17a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
lrpgggdsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfys
iftdqlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvd
tcrkfikas

SCOPe Domain Coordinates for d6y17a_:

Click to download the PDB-style file with coordinates for d6y17a_.
(The format of our PDB-style files is described here.)

Timeline for d6y17a_: