![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102923] (37 PDB entries) |
![]() | Domain d1r2ba_: 1r2b A: [96857] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1r2b (more details), 2.2 Å
SCOPe Domain Sequences for d1r2ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2ba_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf ikase
Timeline for d1r2ba_: