SCOPe 2.08: Domain d6y17b1: 6y17 B:-5-127

Lineage for d6y17b1 (6y17 B:-5-127)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102923] (37 PDB entries)

8. Domain d6y17b1: 6y17 B:-5-127 [396401]
   Other proteins in same PDB: d6y17b2
   automated match to d1r2ba_
   complexed with na
   has additional insertions and/or extensions that are not grouped together

Details for d6y17b1

PDB Entry: 6y17, 1.56 Å

PDB Description: crystal structure of an ncor1bbd2-bcl6btb chimera in complex with nebulinsh3-ncor1bbd1

PDB Compounds: (B:) Nuclear receptor corepressor 1,B-cell lymphoma 6 protein

SCOPe Domain Sequences for d6y17b1:

Sequence, based on SEQRES records:

>d6y17b1 d.42.1.1 (B:-5-127) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
ssdlylrpgggdsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacs
glfysiftdqlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqm
ehvvdtcrkfika

Sequence, based on observed residues (ATOM records):

>d6y17b1 d.42.1.1 (B:-5-127) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
ssdlyldsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfys
iftdqlkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvd
tcrkfika

Timeline for d6y17b1:

• d6y17b1 first appeared in SCOPe 2.07