Lineage for d5teob_ (5teo B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
4 helices, bundle; helix 3 is shorter than others; up-and-downSuperfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) 
Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) 
Protein HIV capsid protein, dimerisation domain [47359] (3 species) 
Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [346174] (1 PDB entry) 
Domain d5teob_: 5teo B: [339615]
automated match to d2xt1a_
Details for d5teob_
PDB Entry: 5teo (more details), 2.05 Å
PDB Description: dimer of hiv-1 gag ctd-sp1 fragment
PDB Compounds: (B:) HIV-1 Gag CTD-SP1SCOPe Domain Sequences for d5teob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5teob_ a.28.3.1 (B:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpg
atleemmtacqgvggpghkarvlaeamsqvtnt
SCOPe Domain Coordinates for d5teob_:
Click to download the PDB-style file with coordinates for d5teob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5teob_:
- d5teob_ first appeared in SCOPe 2.06
- d5teob_ appears in SCOPe 2.07
View in 3D
