PDB entry 5teo

View 5teo on RCSB PDB site
Description: Dimer of HIV-1 Gag CTD-SP1 fragment
Class: viral protein
Keywords: viral capsid protein, dimer, helix, molecular switch, VIRAL PROTEIN
Deposited on 2016-09-22, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV-1 Gag CTD-SP1
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate NY5) [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5teoa_
  • Chain 'B':
    Compound: HIV-1 Gag CTD-SP1
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate NY5) [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered mutation (105)
    Domains in SCOPe 2.07: d5teob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5teoA (A:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records): (download)
    >5teoA (A:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5teoB (B:)
    hmhhhhhhggsptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnan
    pdcktilkalgpgatleemmtacqgvggpghkarvlaeamsqvtntatim
    

    Sequence, based on observed residues (ATOM records): (download)
    >5teoB (B:)
    sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpg
    atleemmtacqgvggpghkarvlaeamsqvtnt