Lineage for d5teob_ (5teo B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993360Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1993622Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1993623Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 1993661Protein automated matches [226861] (4 species)
    not a true protein
  7. 1993676Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [339614] (1 PDB entry)
  8. 1993678Domain d5teob_: 5teo B: [339615]
    automated match to d2xt1a_

Details for d5teob_

PDB Entry: 5teo (more details), 2.05 Å

PDB Description: dimer of hiv-1 gag ctd-sp1 fragment
PDB Compounds: (B:) HIV-1 Gag CTD-SP1

SCOPe Domain Sequences for d5teob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5teob_ a.28.3.1 (B:) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpg
atleemmtacqgvggpghkarvlaeamsqvtnt

SCOPe Domain Coordinates for d5teob_:

Click to download the PDB-style file with coordinates for d5teob_.
(The format of our PDB-style files is described here.)

Timeline for d5teob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5teoa_