Lineage for d5nima1 (5nim A:21-94)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. Protein Ethr repressor [109651] (2 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
    Uniprot P96222 22-215
  8. Domain d5nima1: 5nim A:21-94 [341584]
    Other proteins in same PDB: d5nima2
    automated match to d1t56a1
    protein/DNA complex; complexed with 8ye, so4

Details for d5nima1

PDB Entry: 5nim (more details), 1.5 Å

PDB Description: ethr complex
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5nima1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nima1 a.4.1.9 (A:21-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
sgddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvv
nqadmalqtlaenp

SCOPe Domain Coordinates for d5nima1 are not available.

Timeline for d5nima1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5nima2