Lineage for d5nima1 (5nim A:21-94)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Ethr repressor [109651] (2 species) Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
Uniprot P96222 22-215
Domain d5nima1: 5nim A:21-94 [341584]
Other proteins in same PDB: d5nima2
automated match to d1t56a1
protein/DNA complex; complexed with 8ye, so4
Details for d5nima1
PDB Entry: 5nim (more details), 1.5 Å
PDB Description: ethr complex
PDB Compounds: (A:) HTH-type transcriptional regulator EthRSCOPe Domain Sequences for d5nima1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nima1 a.4.1.9 (A:21-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
sgddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvv
nqadmalqtlaenp
SCOPe Domain Coordinates for d5nima1:
Click to download the PDB-style file with coordinates for d5nima1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5nima1:
- d5nima1 first appeared in SCOPe 2.06
- d5nima1 appears in SCOPe 2.07
View in 3D
