SCOPe 2.08: Domain d5g5aa1: 5g5a A:2-83

Lineage for d5g5aa1 (5g5a A:2-83)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.0: automated matches [191312] (1 protein)
not a true family
Protein automated matches [190056] (195 species)
not a true protein
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)
Domain d5g5aa1: 5g5a A:2-83 [335078]
Other proteins in same PDB: d5g5aa2, d5g5ab2, d5g5ac2, d5g5ad2
automated match to d5agya1
complexed with gsh

Details for d5g5aa1

PDB Entry: 5g5a (more details), 1.95 Å

PDB Description: glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide

PDB Compounds: (A:) glutathione s-transferase u25

SCOPe Domain Sequences for d5g5aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5aa1 c.47.1.0 (A:2-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
adevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihng
npvcesliqieyidevwpsktp

SCOPe Domain Coordinates for d5g5aa1:

Click to download the PDB-style file with coordinates for d5g5aa1.
(The format of our PDB-style files is described here.)

Timeline for d5g5aa1: