Lineage for d5g5ad2 (5g5a D:84-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714244Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries)
  8. 2714284Domain d5g5ad2: 5g5a D:84-220 [335103]
    Other proteins in same PDB: d5g5aa1, d5g5ab1, d5g5ac1, d5g5ad1
    automated match to d5agya2
    complexed with gsh

Details for d5g5ad2

PDB Entry: 5g5a (more details), 1.95 Å

PDB Description: glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide
PDB Compounds: (D:) glutathione s-transferase u25

SCOPe Domain Sequences for d5g5ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5ad2 a.45.1.0 (D:84-220) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
llpsdpyqraqakfwgdfidkkvyasarliwgakgeeheagkkefieilktleselgdkt
yfggetfgyvdialigfyswfeayekfgsfsieaecpkliawgkrcveresvakslpdse
kiikfvpelrkklgiei

SCOPe Domain Coordinates for d5g5ad2:

Click to download the PDB-style file with coordinates for d5g5ad2.
(The format of our PDB-style files is described here.)

Timeline for d5g5ad2: