SCOPe 2.08: Domain d5g5ad2: 5g5a D:84-220

Lineage for d5g5ad2 (5g5a D:84-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries)

8. Domain d5g5ad2: 5g5a D:84-220 [335103]
   Other proteins in same PDB: d5g5aa1, d5g5ab1, d5g5ac1, d5g5ad1
   automated match to d5agya2
   complexed with gsh

Details for d5g5ad2

PDB Entry: 5g5a, 1.95 Å

PDB Description: glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide

PDB Compounds: (D:) glutathione s-transferase u25

SCOPe Domain Sequences for d5g5ad2:

Sequence; same for both SEQRES and ATOM records:

>d5g5ad2 a.45.1.0 (D:84-220) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
llpsdpyqraqakfwgdfidkkvyasarliwgakgeeheagkkefieilktleselgdkt
yfggetfgyvdialigfyswfeayekfgsfsieaecpkliawgkrcveresvakslpdse
kiikfvpelrkklgiei

Timeline for d5g5ad2:

• d5g5ad2 first appeared in SCOPe 2.06
  
• d5g5ad2 appears in SCOPe 2.07