![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries) |
![]() | Domain d5g5aa2: 5g5a A:84-220 [335079] Other proteins in same PDB: d5g5aa1, d5g5ab1, d5g5ac1, d5g5ad1 automated match to d5agya2 complexed with gsh |
PDB Entry: 5g5a (more details), 1.95 Å
SCOPe Domain Sequences for d5g5aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g5aa2 a.45.1.0 (A:84-220) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} llpsdpyqraqakfwgdfidkkvyasarliwgakgeeheagkkefieilktleselgdkt yfggetfgyvdialigfyswfeayekfgsfsieaecpkliawgkrcveresvakslpdse kiikfvpelrkklgiei
Timeline for d5g5aa2: