Lineage for d5a87b_ (5a87 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) Protein automated matches [190079] (12 species)
not a true protein
Species Klebsiella pneumoniae [TaxId:573] [271524] (9 PDB entries) 
Domain d5a87b_: 5a87 B: [279994]
automated match to d2whga_
complexed with gol, zn
Details for d5a87b_
PDB Entry: 5a87 (more details), 1.5 Å
PDB Description: crystal structure of the metallo-beta-lactamase vim-5
PDB Compounds: (B:) metallo-beta-lactamase vim-5SCOPe Domain Sequences for d5a87b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a87b_ d.157.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
epsgeyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtaw
gakntaallaeiekqiglpvtravsthfhddrvggvdvlrkagvatyaspstrrlaeaeg
neipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavlalsrts
agnvadadlaewptsveriqkhypeaevvipghglpggldllqhtanvvtahknr
SCOPe Domain Coordinates for d5a87b_:
Click to download the PDB-style file with coordinates for d5a87b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5a87b_:
- d5a87b_ first appeared in SCOPe 2.05
- d5a87b_ appears in SCOPe 2.07
View in 3D
