Lineage for d4xk8d_ (4xk8 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005547Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 3005548Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 3005549Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 3005562Protein automated matches [236562] (8 species)
    not a true protein
  7. 3005578Species Pea (Pisum sativum) [TaxId:3888] [276208] (9 PDB entries)
  8. 3005581Domain d4xk8d_: 4xk8 D: [310036]
    Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8a_, d4xk8b_, d4xk8c_, d4xk8e_, d4xk8f_, d4xk8j_
    automated match to d4y28d_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d4xk8d_

PDB Entry: 4xk8 (more details), 2.8 Å

PDB Description: crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d4xk8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk8d_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tppeldpntpspifggstggllrkaqveefyvitwdspkeqifemptggaaimregpnll
klarkeqclalgtrlrskykikyqfyrvfpngevqylhpkdgvypekvnagrqgvgqnfr
sigknvspievkftgkqpydl

SCOPe Domain Coordinates for d4xk8d_:

Click to download the PDB-style file with coordinates for d4xk8d_.
(The format of our PDB-style files is described here.)

Timeline for d4xk8d_: