Lineage for d4nl5b_ (4nl5 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.0: automated matches [191316] (1 protein)
not a true familyProtein automated matches [190081] (33 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:1773] [225795] (2 PDB entries) 
Domain d4nl5b_: 4nl5 B: [257991]
automated match to d3hx9a_
complexed with act, cyn, hem
Details for d4nl5b_
PDB Entry: 4nl5 (more details), 1.9 Å
PDB Description: Mycobacterium tuberculosis heme-degrading protein MhuD in complex with heme and cyanide
PDB Compounds: (B:) Heme-degrading monooxygenase HmoBSCOPe Domain Sequences for d4nl5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nl5b_ d.58.4.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesde
afqawangpaiaahaghranpvatgasllefevvldvggt
SCOPe Domain Coordinates for d4nl5b_:
Click to download the PDB-style file with coordinates for d4nl5b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4nl5b_:
- d4nl5b_ first appeared in SCOPe 2.04
- d4nl5b_ appears in SCOPe 2.07
View in 3D
