PDB entry 4nl5

View 4nl5 on RCSB PDB site
Description: Mycobacterium tuberculosis heme-degrading protein MhuD in complex with heme and cyanide
Class: oxidoreductase
Keywords: beta barrel, Oxidoreductase
Deposited on 2013-11-13, released 2014-06-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme-degrading monooxygenase HmoB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: mhuD, MT3698, Rv3592
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4nl5a_
  • Chain 'B':
    Compound: Heme-degrading monooxygenase HmoB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: mhuD, MT3698, Rv3592
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4nl5b_
  • Heterogens: HEM, CYN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nl5A (A:)
    mpvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesd
    eafqawangpaiaahaghranpvatgasllefevvldvggtgktagvprgklaaalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl5A (A:)
    pvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesde
    afqawangpaiaahaghranpvatgasllefevvldvggtg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nl5B (B:)
    mpvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesd
    eafqawangpaiaahaghranpvatgasllefevvldvggtgktagvprgklaaalehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nl5B (B:)
    pvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesde
    afqawangpaiaahaghranpvatgasllefevvldvggt