Lineage for d3hx9a_ (3hx9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950323Species Mycobacterium tuberculosis [TaxId:1773] [225795] (2 PDB entries)
  8. 2950324Domain d3hx9a_: 3hx9 A: [211396]
    automated match to d1iujb_
    complexed with cl, hem

Details for d3hx9a_

PDB Entry: 3hx9 (more details), 1.75 Å

PDB Description: Structure of heme-degrader, MhuD (Rv3592), from Mycobacterium tuberculosis with two hemes bound in its active site
PDB Compounds: (A:) Protein Rv3592

SCOPe Domain Sequences for d3hx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hx9a_ d.58.4.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesde
afqawangpaiaahaghranpvatgasllefevvldvggtg

SCOPe Domain Coordinates for d3hx9a_:

Click to download the PDB-style file with coordinates for d3hx9a_.
(The format of our PDB-style files is described here.)

Timeline for d3hx9a_: