Lineage for d4nl5a_ (4nl5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950323Species Mycobacterium tuberculosis [TaxId:1773] [225795] (2 PDB entries)
  8. 2950326Domain d4nl5a_: 4nl5 A: [257171]
    automated match to d3hx9a_
    complexed with act, cyn, hem

Details for d4nl5a_

PDB Entry: 4nl5 (more details), 1.9 Å

PDB Description: Mycobacterium tuberculosis heme-degrading protein MhuD in complex with heme and cyanide
PDB Compounds: (A:) Heme-degrading monooxygenase HmoB

SCOPe Domain Sequences for d4nl5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nl5a_ d.58.4.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pvvkinaievpagagpelekrfahrahavenspgflgfqllrpvkgeeryfvvthwesde
afqawangpaiaahaghranpvatgasllefevvldvggtg

SCOPe Domain Coordinates for d4nl5a_:

Click to download the PDB-style file with coordinates for d4nl5a_.
(The format of our PDB-style files is described here.)

Timeline for d4nl5a_: