Lineage for d4dncb_ (4dnc B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968640Protein Probable histone acetyltransferase MYST1 [143672] (1 species)
    ESA1 orthologue
  7. 2968641Species Human (Homo sapiens) [TaxId:9606] [143673] (3 PDB entries)
    Uniprot Q9H7Z6 178-448
  8. 2968644Domain d4dncb_: 4dnc B: [194904]
    automated match to d2y0ma_
    complexed with zn

    has additional subdomain(s) that are not in the common domain

Details for d4dncb_

PDB Entry: 4dnc (more details), 2.05 Å

PDB Description: Crystal structure of human MOF in complex with MSL1
PDB Compounds: (B:) Histone acetyltransferase KAT8

SCOPe Domain Sequences for d4dncb_:

Sequence, based on SEQRES records: (download)

>d4dncb_ d.108.1.1 (B:) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}
kyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqpp
gkeiyrksnisvyevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqga
hivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdl
gklsyrsywswvlleilrdfrgtlsikdlsqmtsitqndiistlqslnmvkywkgqhvic
vtpklveehlksaqykkppitvdsvclkwap

Sequence, based on observed residues (ATOM records): (download)

>d4dncb_ d.108.1.1 (B:) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}
kyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqpp
gkeiyrksnisvyevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqga
hivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdl
gklsyrsywswvlleilrdfrgtlsikdlsqmtsitqndiistlqslnmvkyqhvicvtp
klveehlksaqykkppitvdsvclkwap

SCOPe Domain Coordinates for d4dncb_:

Click to download the PDB-style file with coordinates for d4dncb_.
(The format of our PDB-style files is described here.)

Timeline for d4dncb_: