SCOPe 2.08: Domain d4dnca_: 4dnc A:

Lineage for d4dnca_ (4dnc A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Probable histone acetyltransferase MYST1 [143672] (1 species)
   ESA1 orthologue

7. Species Human (Homo sapiens) [TaxId:9606] [143673] (3 PDB entries)
   Uniprot Q9H7Z6 178-448

8. Domain d4dnca_: 4dnc A: [201719]
   automated match to d4dncb_
   complexed with zn
   has additional subdomain(s) that are not in the common domain

Details for d4dnca_

PDB Entry: 4dnc, 2.05 Å

PDB Description: Crystal structure of human MOF in complex with MSL1

PDB Compounds: (A:) Histone acetyltransferase KAT8

SCOPe Domain Sequences for d4dnca_:

Sequence; same for both SEQRES and ATOM records:

>d4dnca_ d.108.1.1 (A:) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}
yvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqppg
keiyrksnisvyevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqgah
ivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdlg
klsyrsywswvlleilrdfrgtlsikdlsqmtsitqndiistlqslnmvkywkgqhvicv
tpklveehlksaqykkppitvdsvclkwappk

Timeline for d4dnca_:

• d4dnca_ first appeared in SCOPe 2.03
  
• d4dnca_ appears in SCOPe 2.07