Lineage for d2y0ma_ (2y0m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968734Protein automated matches [190241] (13 species)
    not a true protein
  7. 2968763Species Human (Homo sapiens) [TaxId:9606] [187321] (16 PDB entries)
  8. 2968775Domain d2y0ma_: 2y0m A: [170509]
    automated match to d2giva1
    complexed with aco, zn

Details for d2y0ma_

PDB Entry: 2y0m (more details), 2.7 Å

PDB Description: crystal structure of the complex between dosage compensation factors msl1 and mof
PDB Compounds: (A:) Probable histone acetyltransferase MYST1

SCOPe Domain Sequences for d2y0ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y0ma_ d.108.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqpp
gkeiyrksnisvyevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqga
hivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdl
gklsyrsywswvlleilrdfrgtlsikdlsqmtsitqndiistlqslnmvkywkgqhvic
vtpklveehlksaqykkppitvdsvclkwappk

SCOPe Domain Coordinates for d2y0ma_:

Click to download the PDB-style file with coordinates for d2y0ma_.
(The format of our PDB-style files is described here.)

Timeline for d2y0ma_: