PDB entry 4dnc

View 4dnc on RCSB PDB site
Description: Crystal structure of human MOF in complex with MSL1
Class: transcription
Keywords: histone acetyltransferase, MOF, MSL, NSL, transcription
Deposited on 2012-02-08, released 2012-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.212
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT8
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT8, MOF, MYST1, PP7073
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dnca_
  • Chain 'B':
    Compound: Histone acetyltransferase KAT8
    Species: Homo sapiens [TaxId:9606]
    Gene: KAT8, MOF, MYST1, PP7073
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dncb_
  • Chain 'D':
    Compound: male-specific lethal 1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: MSL1, MSL1L1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: male-specific lethal 1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: MSL1, MSL1L1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dncA (A:)
    heaitkvkyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgq
    cqwrqppgkeiyrksnisvyevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyilt
    evdrqgahivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgsp
    ekplsdlgklsyrsywswvlleilrdfrgtlsikdlsqmtsitqndiistlqslnmvkyw
    kgqhvicvtpklveehlksaqykkppitvdsvclkwappkhkqvklskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dncA (A:)
    yvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqppg
    keiyrksnisvyevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqgah
    ivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdlg
    klsyrsywswvlleilrdfrgtlsikdlsqmtsitqndiistlqslnmvkywkgqhvicv
    tpklveehlksaqykkppitvdsvclkwappk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dncB (B:)
    heaitkvkyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgq
    cqwrqppgkeiyrksnisvyevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyilt
    evdrqgahivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgsp
    ekplsdlgklsyrsywswvlleilrdfrgtlsikdlsqmtsitqndiistlqslnmvkyw
    kgqhvicvtpklveehlksaqykkppitvdsvclkwappkhkqvklskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dncB (B:)
    kyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqpp
    gkeiyrksnisvyevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqga
    hivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsdl
    gklsyrsywswvlleilrdfrgtlsikdlsqmtsitqndiistlqslnmvkyqhvicvtp
    klveehlksaqykkppitvdsvclkwap
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.