Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (19 species) not a true protein |
Species Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256747] (1 PDB entry) |
Domain d4cyza_: 4cyz A: [256748] Other proteins in same PDB: d4cyzb_, d4cyzd_, d4cyzf_ automated match to d4dj6a_ complexed with edo, nag |
PDB Entry: 4cyz (more details), 2.4 Å
SCOPe Domain Sequences for d4cyza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cyza_ b.19.1.2 (A:) automated matches {Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]} dkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigml igtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygss insagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss tqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk yvnkkslmlatgmrnvpe
Timeline for d4cyza_: