| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (29 species) not a true protein |
| Species Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256742] (3 PDB entries) |
| Domain d4cyzd_: 4cyz D: [262669] Other proteins in same PDB: d4cyza_, d4cyzc_, d4cyze_ automated match to d4cywf_ complexed with edo, nag |
PDB Entry: 4cyz (more details), 2.4 Å
SCOPe Domain Sequences for d4cyzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cyzd_ h.3.1.1 (D:) automated matches {Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
Timeline for d4cyzd_: