Lineage for d4cyzc_ (4cyz C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (25 species)
    not a true protein
  7. 2040739Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256747] (1 PDB entry)
  8. 2040741Domain d4cyzc_: 4cyz C: [257770]
    Other proteins in same PDB: d4cyzb_, d4cyzd_, d4cyzf_
    automated match to d4dj6a_
    complexed with edo, nag

Details for d4cyzc_

PDB Entry: 4cyz (more details), 2.4 Å

PDB Description: Structure of the A_mallard_Sweden_51_2002 H10 Avian Haemmaglutinin in complex with avian receptor analog LSTA
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4cyzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cyzc_ b.19.1.2 (C:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
dkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigml
igtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygss
insagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

SCOPe Domain Coordinates for d4cyzc_:

Click to download the PDB-style file with coordinates for d4cyzc_.
(The format of our PDB-style files is described here.)

Timeline for d4cyzc_: