SCOPe 2.08: Domain d4cyzb_: 4cyz B:

Lineage for d4cyzb_ (4cyz B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256742] (3 PDB entries)

8. Domain d4cyzb_: 4cyz B: [262668]
   Other proteins in same PDB: d4cyza_, d4cyzc_, d4cyze_
   automated match to d4cywf_
   complexed with edo, nag

Details for d4cyzb_

PDB Entry: 4cyz, 2.4 Å

PDB Description: structure of the a_mallard_sweden_51_2002 h10 avian haemmaglutinin in complex with avian receptor analog lsta

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4cyzb_:

Sequence; same for both SEQRES and ATOM records:

>d4cyzb_ h.3.1.1 (B:) automated matches {Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d4cyzb_:

• d4cyzb_ first appeared in SCOPe 2.05
  
• d4cyzb_ appears in SCOPe 2.07