Lineage for d4cyze_ (4cyz E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2370862Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2371293Protein automated matches [190291] (18 species)
    not a true protein
  7. 2371328Species Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256747] (1 PDB entry)
  8. 2371331Domain d4cyze_: 4cyz E: [262670]
    Other proteins in same PDB: d4cyzb_, d4cyzd_, d4cyzf_
    automated match to d4cyza_
    complexed with edo, nag

Details for d4cyze_

PDB Entry: 4cyz (more details), 2.4 Å

PDB Description: Structure of the A_mallard_Sweden_51_2002 H10 Avian Haemmaglutinin in complex with avian receptor analog LSTA
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4cyze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cyze_ b.19.1.2 (E:) automated matches {Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
dkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigml
igtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygss
insagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

SCOPe Domain Coordinates for d4cyze_:

Click to download the PDB-style file with coordinates for d4cyze_.
(The format of our PDB-style files is described here.)

Timeline for d4cyze_: