Lineage for d3wmmm_ (3wmm M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027605Species Thermochromatium tepidum [TaxId:1050] [267912] (5 PDB entries)
  8. 3027608Domain d3wmmm_: 3wmm M: [265703]
    Other proteins in same PDB: d3wmm0_, d3wmm1_, d3wmm2_, d3wmm3_, d3wmm4_, d3wmm5_, d3wmm6_, d3wmm7_, d3wmm8_, d3wmm9_, d3wmma_, d3wmmb_, d3wmmc_, d3wmmd_, d3wmme_, d3wmmf_, d3wmmg_, d3wmmh1, d3wmmh2, d3wmmi_, d3wmmj_, d3wmmk_, d3wmmn_, d3wmmo_, d3wmmp_, d3wmmq_, d3wmmr_, d3wmms_, d3wmmt_, d3wmmu_, d3wmmv_, d3wmmw_, d3wmmx_, d3wmmy_, d3wmmz_
    automated match to d1eysm_
    complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8

Details for d3wmmm_

PDB Entry: 3wmm (more details), 3.01 Å

PDB Description: crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form
PDB Compounds: (M:) Photosynthetic reaction center M subunit

SCOPe Domain Sequences for d3wmmm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wmmm_ f.26.1.1 (M:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi
ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwlmaglf
ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp
hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr
gtaaeraalfwrwtmgfnvtmesihrwawwcavltvitagigillsgtvvdnwylwavkh
gmapaypevvtavnpyeta

SCOPe Domain Coordinates for d3wmmm_:

Click to download the PDB-style file with coordinates for d3wmmm_.
(The format of our PDB-style files is described here.)

Timeline for d3wmmm_: